PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587209.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 246aa    MW: 28244.1 Da    PI: 9.99
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587209.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26.1e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+ +++q G+g +W + + ++g++R++k+c++rw++yl
   XP_009587209.1 14 RGPWSPEEDSKLKSYIEQNGTGgNWIALPPKIGLNRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding34.64.5e-1169111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++  Rt++++k++w++
   XP_009587209.1  69 GGFSEEEDRIICSLYISIGSR-WSIIAAQLP-ERTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.698962IPR017930Myb domain
SuperFamilySSF466891.43E-2511109IPR009057Homeodomain-like
SMARTSM007179.1E-121364IPR001005SANT/Myb domain
PfamPF002499.0E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231569IPR009057Homeodomain-like
CDDcd001675.20E-81662No hitNo description
PROSITE profilePS5129420.52863117IPR017930Myb domain
SMARTSM007173.4E-1067115IPR001005SANT/Myb domain
PfamPF002499.3E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2270117IPR009057Homeodomain-like
CDDcd001674.46E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRAPCCDKN NVKRGPWSPE EDSKLKSYIE QNGTGGNWIA LPPKIGLNRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDRIIC SLYISIGSRW SIIAAQLPER TDNDIKNYWN TRLKKKLFGK  120
QRQKQGSRKG KEINSNMVIS NNNNNNQFPC WPELPILQPI PYSNDEPRFN DHSSIRKLLI  180
KLGGKFSDED QPINEATNPQ YPMDNSLLMQ PIYQNIPINM ISSAPIDNVL GNXVYLPKII  240
ITRKRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-24141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587209.11e-180PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y97e-80RAX3_ARATH; Transcription factor RAX3
TrEMBLM1A1M31e-122M1A1M3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000127021e-122(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.15e-77myb domain protein 84